PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000233010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 417aa    MW: 47367.3 Da    PI: 7.2008
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000233010genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.47.3e-461002262128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    ppG+rF+P d el+v+yL kkv +++l+  + i ev++y+++P+ L  k  k +ekewyfF++rd+ky++g+r++ra+ +gyWkatg dkev+s++
  MDP0000233010 100 PPGYRFNPFDGELIVHYLMKKVLDQPLPP-NRIFEVNLYRHNPEVLAeKYEKYGEKEWYFFTPRDRKYRNGSRPKRAAGDGYWKATGADKEVKSSD 194
                    9*************************999.77**************9344455899**************************************** PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    g++vg +k Lvfy+g+ pkg kt+W+mhe+r+
  MDP0000233010 195 GAVVGWRKALVFYRGKPPKGDKTNWIMHEFRV 226
                    ******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5597253IPR003441NAC domain
PROSITE profilePS5100553.91399253IPR003441NAC domain
PfamPF023659.4E-24100226IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MSSPSKSPSM EPVGQSHPHH KAFVATITQQ VASYSLSPKK RSPAQGDQGQ FTPANESGAS  60
LTANVSAAAD GADHDLSEDE ANSFNNNLKK DQDEFFNSFP PGYRFNPFDG ELIVHYLMKK  120
VLDQPLPPNR IFEVNLYRHN PEVLAEKYEK YGEKEWYFFT PRDRKYRNGS RPKRAAGDGY  180
WKATGADKEV KSSDGAVVGW RKALVFYRGK PPKGDKTNWI MHEFRVKDSP VRSRRGENDM  240
RLDNWVLCRI YKKDKNGKRC DSRNHAEIIS PFSHRMNDEI MEIEMRGDIV DPLPEYDPAL  300
EYDHKYSNKG YSHMASLPNI CGGIPVNMIC NNQIQSVDAA SMNAXCYANM EHSQPLCVRP  360
PSMSSESVLG PYRYMDQSTI LPDXMMXDMK GFGHSPYSTN NYPAQFSSLD HVFPYTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-539825916171NAC domain-containing protein 19
4dul_A2e-539825916171NAC domain-containing protein 19
1ut7_B2e-539825916171NO APICAL MERISTEM PROTEIN
1ut7_A2e-539825916171NO APICAL MERISTEM PROTEIN
1ut4_B2e-539825916171NO APICAL MERISTEM PROTEIN
1ut4_A2e-539825916171NO APICAL MERISTEM PROTEIN
3swp_D3e-539825919174NAC domain-containing protein 19
3swp_C3e-539825919174NAC domain-containing protein 19
3swp_B3e-539825919174NAC domain-containing protein 19
3swp_A3e-539825919174NAC domain-containing protein 19
3swm_D3e-539825919174NAC domain-containing protein 19
3swm_C3e-539825919174NAC domain-containing protein 19
3swm_B3e-539825919174NAC domain-containing protein 19
3swm_A3e-539825919174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366118.10.0PREDICTED: NAC domain-containing protein 77-like
TrEMBLM5X9E71e-147M5X9E7_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-51NAC domain containing protein 32